- Antibody Type:Primary
- Antigen Name:potassium channel, voltage gated shaker related subfamily A, member 3
- Antigen Symbol:KCNA3
- Clonality:Polyclonal
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western Blot:Yes
- Size:100 µg/vial
- Form:Lyophilized
- Gene ID:P22001
- Antigen Synonyms:PCN3|HGK5|HUKIII|KV1.3|MK3|HPCN3|HLK3
- UniProtKB:P22001
- Molecular Weight:63842
- Storage Temperature:At −20˚C for one year. After reconstitution, at 4 ˚C for one month. It can also be aliquotted and stored frozen at −20 ˚C for a longer time. Avoid repeated freezing and thawing.
- Concentration:Add 0.2 ml of distilled water will yield a concentration of 500 μg/ml
- Shipping Temperature:4 °C
- Immunogen:A synthetic peptide corresponding to a sequence at the C-terminus of human KCNA3 (513-544aa EELRKARSNSTLSKSEYMVIEEGGMNHSAFPQ), identical to the related mouse and rat sequences.
- Purification:Immunogen affinity purified
- Cat. No.:76174-156
Rabbit IgG polyclonal antibody for Potassium voltage-gated channel subfamily A member 3(KCNA3) detection. Tested with WB in Human;Mouse;Rat.
Potassium voltage-gated channel, shaker-related subfamily, member 3, also known as KCNA3 or Kv1.3, is a protein that in humans is encoded by the KCNA3 gene. This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. It plays an essential role in T-cell proliferation and activation. This gene appears to be intronless and it is clustered together with KCNA2 and KCNA10 genes on chromosome 1. And Kv1.3 has been reported to be expressed in the inner mitochondrial membrane in lymphocytes. The apoptotic protein Bax has been suggested to insert into theouter mitochondrial membrane and occlude the pore of Kv1.3 via a lysine residue. Thus, Kv1.3 modulation may be one of many mechanisms that contribute to apoptosis.
Add 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 0.05 mg NaN₃.
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Type: Primary
Antigen: KCNA3
Clonality: Polyclonal
Clone:
Conjugation:
Epitope:
Host: IgG
Isotype: Rabbit
Reactivity: Human; Mouse; Rat