Anti-IFNGR1 IgG Polyclonal Antibody
76171-482
- Antibody Type:Primary
- Antigen Symbol:IFNGR1
- Clonality:Polyclonal
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Size:100 µg/vial
- Form:Lyophilized
- Gene ID:P15260
- Molecular Weight:54405
- Storage Temperature:At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
- Concentration:Add 0.2ml of distilled water will yield a concentration of 500 μg/ml.
- Shipping Temperature:4°C
- Immunogen:A synthetic peptide corresponding to a sequence at the C-terminus of human IFNGR1 (443-484aa QELITVIKAPTSFGYDKPHVLVDLLVDDSGKESLIGYRPTED), different from the related mouse sequence by seventeen amino acids.
- Purification:Immunogen affinity purified.
- Cat. No.:76171-482
Rabbit IgG polyclonal antibody for Interferon gamma receptor 1(IFNGR1) detection. Tested with WB, IHC-F, ICC, FCM in Human.
Type: Primary
Antigen: IFNGR1
Clonality: Polyclonal
Clone:
Conjugation:
Epitope:
Host: IgG
Isotype: Rabbit
Reactivity: Human