Anti-GAA IgG Polyclonal Antibody
Catalog # 76171-462
Supplier: Boster Biological Technology
Specifications
- Antibody Type:Primary
- Antigen Symbol:GAA
- Clonality:Polyclonal
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat
- Western Blot:Yes
- Size:100 µg/vial
- Form:Lyophilized
- Gene ID:P10253
- Molecular Weight:105324
- Storage Temperature:At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
- Concentration:Add 0.2ml of distilled water will yield a concentration of 500 μg/ml.
- Shipping Temperature:4°C
- Immunogen:A synthetic peptide corresponding to a sequence in the middle region of human GAA (494-527aa TALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIR), different from the related mouse sequence by eight amino acids, and from the related rat sequence by six amino acids.
- Purification:Immunogen affinity purified.
- Cat. No.:76171-462
Specifications
About this item
Rabbit IgG polyclonal antibody for Lysosomal alpha-glucosidase(GAA) detection. Tested with WB, IHC-P in Human;Rat.
Type: Primary
Antigen: GAA
Clonality: Polyclonal
Clone:
Conjugation:
Epitope:
Host: IgG
Isotype: Rabbit
Reactivity: Human; Rat