To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:
- • State issued document with your organization's Federal Tax ID Number
- • State issued document with your organization's Resale Tax ID Number
- • City or County issued Business License
- • State Department of Health Services License
- • Any other ID issued by the State that includes the business name & address
* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.
Specifications
- Conjugation:Unconjugated
- Source:
- Species:Human
- Size:1 mg
- Environmentally Preferable:
- Storage Conditions:–20 °C
- Protein Synonyms:Galanin neuropeptide
- Protein/Peptide Name:Galanin
- Purity:95%
- Molecular Weight:3157.5 Da
- Sequence:GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
- Cat. No.:103003-398
- Supplier no.:AS-22431
Specifications
About this item
Galanin, a 29 or 30 (in human) amino acid neuropeptide, is found in the central and peripheral nervous systems and displays several important physiological activities. These actions are mediated through distinct G protein-coupled receptors. It has been involved in food behavior, regulation of sleep and mood, control of blood pression and nociception, among others.
Sequence:GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS
MW:3157.5 Da
% peak area by HPLC:95
Storage condition:-20° C