Human Glucagon-Like Peptide 1, GLP-1 (7-37)

GLP-1 (7-37) is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of proglucagon. Both GLP-1 (7-36) and GLP-1 (7-37) play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. Although GLP-1 (7-37) is bioactive, it is available in lesser amounts than GLP-1 (7-36) and is not amidated.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
MW: 3355.7 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:

• State issued document with your organization's Federal Tax ID Number
• State issued document with your organization's Resale Tax ID Number
• City or County issued Business License
• State Department of Health Services License
• Any other ID issued by the State that includes the business name & address

* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.

Conjugation:
Unconjugated
Species:
Human
Storage Conditions:
–20 °C
Protein Synonyms:
Glucagon-like Peptide 1 (7-37)
Protein/Peptide Name:
Glucagon-like Peptide 1, GLP-1 (7-37)
Purity:
95%
Molecular Weight:
3355.7 Da
Sequence:
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG