Human Beta-Amyloid (1-37)

About this item

Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42. Additional minor Aβ peptides are also normally produced, such as Beta-amyloid 1-34, 1-37, 1-38 and 1-39, and few reports have quantified the levels of these peptides in the brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
Molecular Weight: 4074.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Restricted Products: To process your orders without delay, please provide the required business documentation to purchase this product.

To order chemicals, medical devices, or other restricted products please provide ID that includes your business name & shipping address via email [email protected] or fax 484.881.5997 referencing your VWR account number. Acceptable forms of ID are:

• State issued document with your organization's Federal Tax ID Number
• State issued document with your organization's Resale Tax ID Number
• City or County issued Business License
• State Department of Health Services License
• Any other ID issued by the State that includes the business name & address

* ATTN: California Customers may require additional documentation as part of the CA Health & Safety Code. Products that fall under this regulation will be placed on a mandatory 21-day hold after documentation is received. Avantor will not lift restrictions for residential shipping addresses.