Anti-HNRPH1 Rabbit Polyclonal Antibody
Catalog # 102024-294
Supplier: Avantor
Specifications
- Antibody Type:Primary
- Antigen Symbol:HNRPH1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Western Blot:Yes
- Size:50 µg
- Format:Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of HNRPH1 antibody in PBS
- Storage Temperature:Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
- Concentration:1 mg/ml
- Immunogen:HNRPH1 antibody was raised using the middle region of Hnrph1 corresponding to a region with amino acids FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG
- Cat. No.:102024-294
- Supplier no.:70R4663
Specifications
About this item
HNRPH1 belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm.
WB: 1 ug/ml
Type: Primary
Antigen: HNRPH1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype:
Reactivity: