Some Products May Appear Restricted
To ensure a smooth and speedy checkout, please log in to your account. Some items may show as restricted simply because you're not logged in.
If you do not have an account, you can register using our registration webform (https://www.avantorsciences.com/us/en/login/register)
If you're still seeing restrictions after logging in, certain products—like chemicals or medical devices—require additional account verification steps to be able to place an order. Some items may additionally require a specific license or customer documentation; additional documentation will be requested for these items prior to shipment.
- Conjugation:Unconjugated
- Protein/Peptide Type:Recombinant
- Source:E. coli
- Species:Human
- Size:0.1 mg
- Endotoxin Content:<1.0 EU/µg
- Reconstitution Instructions:Add 0.1 M acetate buffer pH 4 to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. For conversion into higher pH value, we recommend intensive dilution by relevant buffer to a concentration of 10 μg/ml. In higher concentrations the solubility of this antigen is limited. Product is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.
- Protein Synonyms:UNQ2976/PRO7455/PRO7476|SOST
- Protein/Peptide Name:Sclerostin Human E. coli
- Purity:>90%
- Molecular Weight:22.8 kDa (calculated)
- Sequence:MKHHHHHHASQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
- Endotoxin Level:<1.0 EU/µg
- Formulation:Filtered (0.4 μm) and lyophilized in 0.5 mg/ml in 0.03 M Acetate buffer pH 4.0
- Shipping Temperature:At ambient temperature
- Tested Applications:Western blotting, ELISA
- Cat. No.:101169-488
- Supplier no.:RD172244100
Total 200 AA. MW: 22.8 kDa (calculated). UniProtKB acc.no. Q9BQB4 (Gln24-Tyr213). N-terminal His-tag (10 extra AA). Protein identity confirmed by LC-MS/MS.
- Quality control test
- BCA to determine quantity of the protein
- SDS PAGE to determine purity of the protein
- LAL to determine quantity of endotoxin