About this item
>97% Pure Recombinant Blue Fluorescent Protein (BFP)
The recombinant Blue Fluorescent Protein (BFP) is expressed and purified from transformed E. coli using a method that ensures high purity and maximal BFP fluorescence. The protein is a 29 kDa monomer with 259 amino acids, pI: 6.17. Ex.= 308-383 nm; Em.= 440-447 nm. The protein is engineered with 6xHis-tag on the N-terminal, which can be used for detection with anti-His-Tag antibody, or protein removal by using Ni++ beads. BFP protein sequence:MGSSHHHHHHSSGLVPRGSHMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATY
GKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF
FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKN
GIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSALSKDPNEKRDHMV
LLEFVTAAGITLGMDELYK
Specifications
- Source:E. coli
- Endotoxin Content:<0.1 ng/μg
- Reconstitution Instructions:Reconstitute with dH₂O to 1 mg/ml
- Protein Synonyms:B
- Protein/Peptide Name:Blue Fluorescent
- Purity:>97%
- Molecular Weight:29.0 kDa
- Formulation:Freeze Dried