Specifications
- Antibody Type:Primary
- Antigen Name:Presenilin 2 loop region
- Antigen Symbol:PSNL2
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoPrecipitation:Yes
- Isotype:IgG
- Western Blot:Yes
- Size:500 µg
- Epitope:Human PS1 [306-334] in the loop region
- Cross Adsorption:No
- Format:Lyophilized
- Antigen Synonyms:STM-2|E5-1|AD3LP|AD5
- Immunogen:A synthetic peptide (KLDPSSQGALQLPYDPEMEEDSYDSFGEP-C) corresponding to human PS1 [306-334] in the loop region conjugated via additional C-terminal Cys to Diphtheria toxoid.
- Cat. No.:10782-556
- Supplier no.:R-1681-500
Specifications
About this item
Autosomal dominant mutations in presenilin 2 are the second major cause of early-onset familial Alzheimer's disease. Presenilin 2 is a multi-transmembrane protein which undergoes endoprotelysis to form an N-terminal fragment of about 29 kDa and C-terminal fragment of about 22 kDa. Presenilin 2 forms the catalytic core of the gamma-secretase complex which cleaves type 1 transmembrane proteins including the amyloid precursor protein to generate the C-terminus of the amyloid beta peptide.
Confirmed by Western blot using mouse and human brain and knock down of presenilin 2 in vitro using siRNA see ref 6 below. Not reactive with presenilin 1.
Application Information:
WB and IP. Suggested dilution of 1:1,000 is recommended for WB. Full length presenilin 2 (448 aa) has relative MW of about 45 kDa, with this antibody most commonly detected as cleaved CTF of 22 kDa with this antibody. Human or mouse brain samples commonly prepared with reducing agent (50mM DTT), urea (2.3 M), SDS (1.5%) in 62.5 mM Tris-HCL pH 6.8 sample buffer (without boiling) heating to 50 C for 15 min. The suggested dilution for IP is 1:100 . Biosensis recommends that the optimal working dilution should be determined by the end user.
Type: Primary
Antigen: Presenilin 2 loop region
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope: Human PS1 [306-334] in the loop region
Host: Rabbit
Isotype: IgG
Reactivity: