Anti-SIGMAR1 Rabbit Polyclonal Antibody
10737-140
: Abnova
- Antibody Type:Primary
- Antigen Name:Sigma Non-Opioid Intracellular Receptor 1
- Antigen Symbol:SIGMAR1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 µL
- Cross Adsorption:No
- Format:Liquid
- Gene ID:10280
- Antigen Synonyms:SR31747-binding protein|Sigma1-receptor|OPRS1|Aging-associated gene 8 protein|SR-BP|hSigmaR1|Sigma1R|SIG-1R|Sigma 1-type opioid receptor
- Storage Buffer:PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
- Sequence:FVFQREEIAQLARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGG
- Storage Temperature:Store at 4 °C. For long term storage store at –20 °C. Aliquot to avoid repeated freezing and thawing.
- Immunogen:Recombinant protein corresponding to amino acids of human SIGMAR1.
- Purification:Antigen affinity purification
- Cat. No.:10737-140
- Supplier no.:PAB20993
Rabbit polyclonal antibody raised against recombinant SIGMAR1.
Recommended Dilutions: Immunohistochemistry: 1:10-1:20; Western Blot: 1:250-1:500
Type: Primary
Antigen: SIGMAR1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human