Anti-INSL6 Rabbit Polyclonal Antibody
Catalog # 10721-416
Supplier: Abnova
Specifications
- Antibody Type:Primary
- Antigen Name:Insulin-like 6
- Antigen Symbol:INSL6
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Western Blot:Yes
- Size:100 µL
- Cross Adsorption:No
- Format:Liquid
- Gene ID:11172
- Antigen Synonyms:RIF1
- Storage Buffer:PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
- Sequence:SARKLCGRYLVKEIEKLCGHANWSQFRFEEETPFSRLIAQASEKVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKD
- Storage Temperature:Store at 4 °C. For long term storage store at –20 °C. Aliquot to avoid repeated freezing and thawing.
- Immunogen:Recombinant protein corresponding to amino acids of human INSL6.
- Purification:Antigen affinity purification
- Cat. No.:10721-416
- Supplier no.:PAB21394
Specifications
About this item
Rabbit polyclonal antibody raised against recombinant INSL6.
Recommended Dilutions: Immunohistochemistry: 1:200-1:500; Western Blot: 1:250-1:500
Type: Primary
Antigen: INSL6
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human