Anti-VRTN Rabbit Polyclonal Antibody
10703-606
: Abnova
- Antibody Type:Primary
- Antigen Name:vertebrae development associated
- Antigen Symbol:VRTN
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Size:100 µL
- Cross Adsorption:No
- Format:Liquid
- Gene ID:55237
- Antigen Synonyms:C14orf115|vertnin
- Storage Buffer:PBS, pH 7.5 (40% glycerol, 0.02% sodium azide)
- Sequence:ATLEAIFDADVKASCFPSSFSNVWHLYALASVLQRNIYSIYPMRNLKIRPYFNRVIRPRRCDHVPSTLHIMWAGQPLTSHFFRHQYFAPVVGLEEVEAEGAPGVAPALPALAPLSSPAKTLELLNREPGLSYSHLC
- Storage Temperature:Store at 4 °C. For long term storage store at –20 °C. Aliquot to avoid repeated freezing and thawing.
- Immunogen:Recombinant protein corresponding to amino acids of human C14orf115.
- Purification:Antigen affinity purification
- Cat. No.:10703-606
- Supplier no.:PAB20060
Rabbit polyclonal antibody raised against recombinant C14orf115.
Recommended Dilutions: Immunohistochemistry: 1:50-1:200
Type: Primary
Antigen: VRTN
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human