Anti-CAT3/SLC7A3 Rabbit Polyclonal Antibody
Catalog # 103271-636
Supplier: Avantor
Specifications
- Antibody Type:Primary
- Antigen Symbol:CAT3/SLC7A3
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Size:100 μl
- Gene ID:84889
- Antigen Synonyms:y+ system)|CAT-3Cationic amino acid transporter y+|FLJ14541|ATRC3cationic amino acid transporter 3|member 3|CAT3|solute carrier family 7 (cationic amino acid transporter|MGC20687|Solute carrier family 7 member 3
- Storage Buffer:PBS (pH 7.2) and 40% Glycerol
- Storage Temperature:Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids:RYQPDQETKTGEEVELQEEAITTESEKLTLWGLFFPLNSIPTPLSGQI
- Purification:Immunogen affinity purified
- Cat. No.:103271-636
- Supplier no.:NBP1-88910
Specifications
About this item
The CAT3 / SLC7A3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CAT3 / SLC7A3. This antibody reacts with human. The CAT3 / SLC7A3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: CAT3/SLC7A3
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human
Frequently Bought Together