You searched for: Proteins and Peptides
Proteins are used in routine laboratory procedures such as binding enzymes or coupling peptides to carrier proteins. These kits, mixture solutions, and collagen matrices fulfill a myriad of essential laboratory functions for developing relationships between proteins and other cellular components. The stimulating proteins offered have various amino acid arrangements and functions to fulfill any sample manipulation for testing purposes in any field.
Rat Adrenomedullin (1-50)
Supplier: Anaspec Inc
Rat adrenomedullin, rADM, (1-50) and its C-terminal rADM (11-50) induce a dose-dependent and endothelium-independent vasodilation on the arterial mesenteric vasculature.
Sequence:YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Disulfide bridge: 14-19)
MW:5729.5 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Expand 1 Items
Human Adiponectin (Trimeric Form) (from HEK293 cells)
Supplier: BioVendor
Adiponectin, also referred to as Acrp30, AdipoQ and GBP-28, is a recently discovered 244 aminoacid protein, the product of the apM1 gene, which is physiologically active and specifically and highly expressed in adipose cells. The protein belongs to the soluble defence collagen superfamily; it has a collagen-like domain structurally homologous with collagen VIII and X and complement factor C1q-like globular domain. Adiponectin forms homotrimers, which are the building blocks for higher order complexes found circulating in serum. Together, these complexes make up approximately 0.01% of total serum protein.
Expand 1 Items
Bacteriophage Recombinant UvsY Glycerol-Free (from E. coli)
Supplier: INTACT GENOMICS, INC MS
UvsY is the phage T4 recombination mediator protein, and structural and biophysical studies provide insights into its role in T4 homologous recombination. During T4 homologous recombination, the UvsX recombinase must compete with the prebound gp32 single-stranded binding protein for DNA-binding sites and T4 UvsY Protein stimulates this filament nucleation event. UvsY is a 15.8 kDa protein with properties that are consistent with its role as mediator; it stimulates the DNA-dependent ATPase activity of UvsX, lowers the critical concentration of UvsX that is required for activity, and promotes strand exchange (2, 3).
Expand 3 Items
Human Recombinant GPX3 (from HEK293 cells)
Supplier: Adipogen
Glutathione peroxidase 3 (GPX3) is a selenium-dependent extracellular enzyme, protecting cells and enzymes from oxidative damage by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxides. GPX3 is involved in inflammatory bowel disease, in asthma and in diabetes. The activity of GPX3 is significantly reduced in the plasma and tissue of cancer patients. Recently, GPX3 was suggested to serve as a molecular marker for the diagnosis of clear cell type ovarian adenocarcinoma.
Expand 2 Items
Human Recombinant CD137 (from E. coli)
Supplier: Adipogen
Human CD137 (4-1BB) is a costimulatory molecule of the tumor necrosis factor (TNF) receptor superfamily. The glycoprotein 4-1BB is expressed mainly on activated CD4+ and CD8+ T cells and binds to a high-affinity ligand (4-1BBL) expressed on several antigen-presenting cells such as macrophages and activated B cells. Upon ligand binding, 4-1BB is associated with the tumor receptor-associated factors (TRAF), the adaptor protein and mediates downstream signaling events including the activation of NF-kappaB and cytokine production. 4-1BB signaling either by binding to 4-1BBL or by antibody ligation delivers signals for T cell activation and growth as well as monocyte proliferation and B cell survival, and plays a important role in the amplification of T cell-mediated immune responses. In contrast, it can also enhance activation-induced T cell apoptosis when triggered by engagement of the TCR/CD3 complex. In addition, the 4-1BB/4-1BBL costimulatory pathway has been shown to augment secondary CTL responses to several viruses and increase antitumor immunity. 4-1BB is therefore a promising candidate for immunotherapy of human cancer.
Expand 1 Items
Methacrylated Gelatin
Supplier: ADVANCED BIOMATRIX, INC. MS
PhotoGel® is 1 gram (2 x 500 mg) of lyophilized methacrylated gelatin. PhotoGel® provides 3D gelatin hydrogels with the unique attributes to be prepared at various concentrations and photocrosslinked (requires a photoinitiator) to provide various gel stiffness.
Expand 1 Items
Streptavidin, Poly-HRP (Horseradish Peroxidase), Pierce Chemical
Supplier: Invitrogen
Poly-HRP Streptavidin consists of streptavidin protein that is covalently conjugated to a polymerized form of horseradish peroxidase (HRP) enzyme. Streptavidin binds to biotin and the conjugated HRP polymer provides a high level of activity for detection using an appropriate substrate system. This particular Poly-HRP Streptavidin product has been used primarily in sandwich ELISA applications to improve the signal provided by typical (non-Poly) streptavidin-HRP conjugates.
Expand 1 Items
Staphylococcus aureus Recombinant Protein A (from E. coli), HiLyte Fluor® 647
Supplier: Anaspec Inc
Protein A-HiLyte™ Fluor 647 Conjugate can be used as a universal reagent to detect primary antibodies in IHC from many species including rabbit, human, some mouse IgG isotypes, and others. Fluorescence (near-infrared) Excitation/Emission wavelength: 649 nm/674 nm.
AnaSpec's recombinant Protein A consists of only IgG binding domains and was expressed using a recombinant bacterial expression system. Its apparent molecular weight is approximately 30,000 Da compared to 42,000 Da for the native Protein A that is found in Staphylococcus aureus.
Protein A conjugates are widely used as labeled reagents for a variety of experiments including immunoprecipitation, antibody detection and purification and assay development
Expand 1 Items
Mouse Recombinant CD276 (from CHO cells)
Supplier: Adipogen
CD276 (B7-H3) is a member of the B7/CD28 superfamily of costimulatory molecules serving as an accessory modulator of T cell response. B7 family molecules, which are expressed on antigen-presenting cells and display extracellular regions containing immunoglobulin (Ig) variable (V)- and constant (C)-like domains, are known to modulate T cell receptor (TCR)-mediated T cell activation by providing co-signals that are either stimulatory or inhibitory. B7-H3 provides a stimulatory signal to T cells. However, recent studies suggest a negative regulatory role for B7-H3 in T cell responses. B7-H3 inhibited T cell proliferation mediated by antibody to T cell receptor or allogeneic antigen-presenting cells. B7-H3 is a negative regulator that preferentially affects T(H)1 responses. B7-H3 may play an important role in muscle-immune interactions, providing further evidence of the active role of muscle cells in local immunoregulatory processes. Recently, B7-H3 expression has also been found in a variety of different human cancers, including prostate cancer, clear cell renal cell carcinoma (ccRCC), non-small-cell lung cancer (NSCLC), pancreatic cancer, gastric cancer, ovarian cancer, colorectal cancer (CRC) and urothelial cell carcinoma. B7-H3 was expressed in some human cancers and correlated with poor outcome of cancer patients.
Expand 1 Items
Human CD155 (from CHO cells)
Supplier: Adipogen
Human CD155 (Polio Virus Receptor, PVR, Necl-5) is a 70kd type I Ig superfamily molecule. It is involved in formation of intracellular junctions between epithelial cells. Its ligands include CD226 (DNAM-1), and CD96 (TACTILE). CD155 expression by tumor has been shown to be upregulated by nitric oxide. A soluble version of CD155 has been shown to exist. High CD155 expression has recently been exploited to use engineered poliovirus to treat glioblastoma.
Expand 1 Items
Human CD155 (from CHO cells)
Supplier: Adipogen
Human CD155 (Polio Virus Receptor, PVR, Necl-5) is a 70kd type I Ig superfamily molecule. It is involved in formation of intracellular junctions between epithelial cells. Its ligands include CD226 (DNAM-1), and CD96 (TACTILE). CD155 expression by tumor has been shown to be upregulated by nitric oxide. A soluble version of CD155 has been shown to exist. High CD155 expression has recently been exploited to use engineered poliovirus to treat glioblastoma.
Expand 1 Items
Human Recombinant FN14 (from HEK293 cells)
Supplier: Adipogen
TWEAK is a cytokine that controls proliferation, migration, differentiation, apoptosis, angiogenesis and inflammation. TWEAK binds to Fn14, a highly inducible cell-surface receptor that is linked to several intracellular signalling pathways, including the nuclear factor-B (NF-kappaB) pathway. The TWEAK–Fn14 axis plays a beneficial role in tissue repair following acute injury and may contribute to cancer, chronic autoimmune diseases and acute ischaemic stroke.
Expand 2 Items
ApoScreen® Human Recombinant Annexin V (from E. coli), Cy5®
Supplier: Southern Biotechnology
ApoScreen® Annexin V (SB Cat. No. 10040) is a recombinant protein that is expressed in E. coli. A number of changes in cell structure occur during apoptosis. One major change is the loss of membrane phospholipid asymmetry, with translocation of phosphatidylserine (PS) from the inner leaflet of the phospholipid bilayer to the external surface. Annexin V, a member of the annexin family of calcium-dependent phospholipid binding proteins, has a high affinity for phosphatidylserine (PS)-containing phospholipid bilayers. Conjugated Annexin V can be used to monitor changes in cell membrane phospholipid asymmetry, thereby providing a convenient tool for detection of apoptotic cells.
Expand 1 Items
ApoScreen® Human Recombinant Annexin V (from E. coli)
Supplier: Southern Biotechnology
ApoScreen® Annexin V (SB Cat. No. 10040) is a recombinant protein that is expressed in E. coli. A number of changes in cell structure occur during apoptosis. One major change is the loss of membrane phospholipid asymmetry, with translocation of phosphatidylserine (PS) from the inner leaflet of the phospholipid bilayer to the external surface. Annexin V, a member of the annexin family of calcium-dependent phospholipid binding proteins, has a high affinity for phosphatidylserine (PS)-containing phospholipid bilayers. Conjugated Annexin V can be used to monitor changes in cell membrane phospholipid asymmetry, thereby providing a convenient tool for detection of apoptotic cells.
Expand 1 Items
Human Recombinant Oncostatin M, ACF
Supplier: STEMCELL Technologies
Oncostatin M (OSM) is a member of interleukin 6 (IL-6) family of cytokines and bears close resemblance to leukemia inhibitory factor (LIF) and granulocyte colony-stimulating factor (G-CSF) in amino acid sequence and its modulation of differentiation in a variety of cell types (Rose and Bruce). OSM signals through type I receptor (consisting of gp130 and LIF receptor [LIFR]) and type II receptor (consisting of gp130 and OSM receptor [OSMR]), which eventually activate the JAK/STAT pathway (Auguste et al.; Gómez-Lechón). OSM is primarily produced by activated T cells and monocytes, and also by activated macrophages, neutrophils, mast cells, and dendritic cells. OSM is also produced within the bone microenvironment by cells of both hematopoietic and mesenchymal origin, including osteocytes and osteoblasts. OSM is involved in differentiation, cell proliferation, hematopoiesis, and inflammation, and also has been shown to have implications in liver development and bone formation and resorption (Sims and Quinn; Tanaka and Miyajima). This product is animal component-free.
Expand 3 Items
Human Regenerating I (fromE. coli)
Supplier: BioVendor
Regenerating (Reg) gene family belongs to the calcium depending lectin gene super family. It represents a group of small, multi‑functional secreted proteins, which can function as acute phase reactants, lectins and anti‑apoptotic or growth agents. These agents play an important role in proliferation and differentiation in the entire GI tract. The Reg family consists of seven members in mice (Reg I, Reg II, Reg IIIa, Reg IIIb, Reg IIId and Reg IIIge and Reg IV). Four members are recognized in humans (Reg Ia, Reg Ib, Reg III and Reg IV), but there are most probably a few more. Reg genes are up‑regulated following tissue injury, and play a major role in the healing of gastrointestinal mucosal lesions. Different members of the Reg gene family were shown to be expressed in pancreatic, gastric and colorectal cancers, and may serve as markers for poor prognosis. Reg IV, a novel member of the family, was suggested to play an important role in initiating the multi‑step process of colorectal cancer carcinogenesis, at the level of adenoma, by increasing the resistance for programmed cell death. Regenerating gene family member 4 (REG4) was originally identified by sequencing of a cDNA library derived from patients with inflammatory bowel disease.
Expand 1 Items
Human Recombinant ATG3 (from E. coli)
Supplier: Adipogen
ATG3 (Autophagy-related protein 3; APG3-like; PC3-96) is an ubiquitous member of the ATG3 family of proteins. It belongs to the autophagin protein family important in autophagy, the biological process which is involved in degradation of endogenous proteins and damaged organelles. ATG3 is an E2-like enzyme involved in the initial stages of autophagocytosis, autophagy and mitochondrial homeostasis. Autophagocytosis is a starvation-induced process responsible for the transport of cytoplasmic proteins to the lysosome/vacuole. It catalyzes the transfer of ATG7-bound ATG8 (LC3; GATE16; GABA-RAP in mammals) to phosphatidylethanolamine, which is essential for autophagy. It acts as an autocatalytic E2-like enzyme, catalyzing the conjugation of ATG12 to itself. The ATG12 conjugation to ATG3 plays a role in mitochondrial homeostasis but not in autophagy.
Expand 2 Items
Poly-L-Lysine
Supplier: ADVANCED BIOMATRIX, INC. MS
Poly-L-Lysine is a synthetic amino acid chain that is positively charged having one hydrobromide per unit of Lysine. Poly-L-Lysine is widely used as a coating to enhance cell attachment and adhesion to both plasticware and glass surfaces. This molecule has been used to culture a wide variety of cell types. Certain cell types secrete proteases, which can digest Poly-L-Lysine. For those cell types, Poly-D-Lysine 000 Da) being less viscous and higher molecular weight (>300,000 Da) having more binding sites per molecule. This product’s molecular weight ranges from 70,000 to 150,000 Da yielding a solution viscosity for easy handling while providing sufficient binding sites for cell attachment.
Poly-L-Lysine surface coatings are designed to improve cell attachment, growth and differentiation of many cell types. Coated surfaces will often improve cell attachment in reduced or serum-free conditions. This product is supplied in a sterile 50 ml package size at a concentration of 0.1 mg/ml.
Expand 1 Items
Human Neuroglobin (from E. coli)
Supplier: BioVendor
Neuroglobin, 151 amino acid reside protein, mainly expressed in vertebrate brain and retina, is a recently identified member of the globin superfamily. Augmenting O(2) supply, neuroglobin promotes survival of neurons upon hypoxic injury, potentially limiting brain damage. Moreover, neuroglobin may be a novel oxidative stress-responsive sensor for signal transduction in the brain. Neuroglobin expression is increased by neuronal hypoxia in vitro and focal cerebral ischemia in vivo, and neuronal survival after hypoxia is reduced by inhibiting neuroglobin expression with an antisense oligodeoxynucleotide and enhanced by neuroglobin overexpression
Expand 1 Items
Amastatin Hydrochloride
Supplier: Adipogen
Slow, tight binding and competitive aminopeptidase (AP) inhibitor. Inhibits cytosolic leucine aminopeptidase, microsomal aminopeptidase M and bacterial leucine aminopeptidase, human serum aminopeptidase A (AP-A), aminopeptidase N (AP-N), tyrosine aminopeptidase, but not aminopeptidase B (AP-B).
Expand 2 Items
Human Recombinant IL-22
Supplier: STEMCELL Technologies
Interleukin 22 (IL-22) is a class 2 α-helical cytokine that signals through the class 2 cytokine receptor and activates the JAK/STAT pathway. IL-22 is secreted by Th1, Th2, Tc22, and γδ T cells, dendritic, mast and NK cells. It stimulates expression of antimicrobial peptides from epithelial cells, thus hindering bacterial infections. Depending on the interactions with other cytokines, IL-22 can either promote inflammation or prevent tissue destruction by regulating host defense and tissue homeostasis at barrier surfaces (Sonnenberg et al.).
Expand 1 Items
Human Recombinant CD160 (from CHO cells)
Supplier: Adipogen
CD160 is a GPI-anchored lymphocyte surface receptor in which expression is mostly restricted to the highly cytotoxic CD56(dim) CD16(+) peripheral blood NK subset. CD160 is a receptor showing broad specificity for both classical and non-classical MHC class I molecules. CD160 acts as a co-activator receptor for CD3-induced proliferation of CD4+ CD160+ T cells isolated from inflammatory skin lesions. CD160-Fc fusion protein targets a novel costimulatory pathway and prolongs allograft survival.
Expand 1 Items
Rat Telocollagen Type I (from Tail)
Supplier: ADVANCED BIOMATRIX, INC. MS
RatCol® Type I Acid Soluble Rat Tail Collagen contains 100 mg at a concentration of approximately 4 mg/mL in a 0.02M acetic acid solution (pH 2 to 3). RatCol® collagen is soluble telo-collagen. Each product includes a bottle containing 100 mg of collagen solution accompanied with a bottle of pre-formulated neutralizing solution for the formation of a collagen gel. This collagen product is provided in user-friendly packaging for use and storage. This product is sterile filtered and is supplied as a ready to use solution. The concentration for each specific lot is provided on the product label and on a Certificate of Analysis that is available with the purchase of each product.
This product is ideal for coating of surfaces, providing preparation of thin layers for culturing cells, or use as a solid gel. RatCol® collagen is suitable for applications using a variety of cell lines including hepatocytes, fibroblasts and epithelial cells.
Expand 1 Items
Human Growth Hormone Releasing Factor, GRF (1-29), amide
Supplier: Anaspec Inc
This hypophysiotropic peptide was isolated from human hypothalamic-hypophysial tissues. Within this 1 to 29 amino acid GRF fragment, amino acids 13 to 21 are more important than 24 to 29 for high affinity receptor binding. Structure–activity studies show that hpGRF(1–29)-NH2 has full intrinsic activity and potency in vitro as the full length GRF in stimulating growth hormone release. Human GRF (1-29) has a high degree (>93%) homology with procine, bovine and ovine GRF (1-29)-NH2.
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
MW: 3357.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Expand 2 Items
Mouse Recombinant Angiopoietin (from HEK293 cells)
Supplier: Adipogen
Angiopoietin-1 (Ang-1) and Angiopoietin-2 (Ang-2) are closely related secreted ligands which bind with similar affinity to Tie-2. Tie-2 and angiopoietins have been shown to play critical roles in embryogenic angiogenesis and in maintaining the integrity of the adult vasculature. Ang-1 activates Tie-2 signaling on endothelial cells to promote chemotaxis, cell survival, cell sprouting, vessel growth and stabilization. Ang-2 has been identified as a secreted protein ligand of Tie-2 and has alternatively been reported to be an antagonist for Ang-1 induced Tie-2 signaling as well as an agonist for Tie-2 signaling, depending on the cell context.
Expand 2 Items
Staphylococcus aureus Recombinant Protein A (from E. coli), HiLyte Fluor® 555
Supplier: Anaspec Inc
Protein A-HiLyte™ Fluor 555 Conjugate can be used as a universal reagent to detect primary antibodies in IHC from many species including rabbit, human, some mouse IgG isotypes, and others. Fluorescence (orange) Excitation/Emission wavelength: 553 nm/568 nm.
AnaSpec's recombinant Protein A consists of only IgG binding domains and was expressed using a recombinant bacterial expression system. Its apparent molecular weight is approximately 30,000 Da compared to 42,000 Da for the native Protein A that is found in Staphylococcus aureus.
Protein A conjugates are widely used as labeled reagents for a variety of experiments including immunoprecipitation, antibody detection and purification and assay development
Expand 1 Items
Human Recombinant BAFF-R (from HEK293 cells)
Supplier: Adipogen
BAFF is mainly produced by innate immune cells such as neutrophils, monocytes, macrophages, dendritic cells, follicular dendritic cells. T cells, activated B cells, some malignant B cells and also non-lymphoid cells like astrocytes, synoviocytes and epithelial cells can also produce BAFF. BAFF binds three distinct receptors (BAFF-R, TACI and BCMA) expressed predominantly on B cells, although activated T cells also express BAFF-R. BAFF is a master regulator of peripheral B cell survival, and together with IL-6, promotes Ig class-switching and plasma cell differentiation . Besides its major role in B cell biology, BAFF co-stimulates activated T cells. Deregulated expression of BAFF leads to autoimmune disorders in mice. In humans, elevated levels of soluble BAFF have been detected in the serum of patients with various autoimmune diseases, such as Sjögren’s syndrome, Rheumatoid Arthritis (RA), Multiple sclerosis (MS) and Systemic Lupus Erythematosus (SLE) . BAFF is also increased levels in some lymphoid cancers.
Expand 2 Items
Human Recombinant Myostatin
Supplier: STEMCELL Technologies
Myostatin is a member of transforming growth factor beta (TGF-β) superfamily that signals by binding to activin type II receptor, resulting in the recruitment of either ALK3 or ALK4 coreceptor, and activation of SMAD2/3 (Kondás et al.). It is released by myocytes and inhibits muscle growth and ability to regenerate (Lee and Lee). Myostatin appears to affect the lipid catabolic metabolism of adipocytes and inhibits preadipocyte differentiation, as demonstrated in the 3T3-L1 cell line (Li et al.).
Expand 2 Items
Human Recombinant TGF-beta 1
Supplier: STEMCELL Technologies
Add this high-quality human recombinant transforming growth factor beta 1 (TGF-β1) to your cell culture workflow. Its verified endotoxin level of ≤0.2 EU/μg, measured using the LAL method, allows confidence for use across multiple applications. A member of the TGF-β superfamily, TGF-β1 regulates diverse cellular phenotypes. TGF-β1 binds to serine-threonine kinase type I and II receptors and activates signal transduction through SMAD2/3 proteins.
Expand 4 Items
Human Recombinant CD278 (from CHO Cells)
Supplier: Adipogen
CD278, also called inducible costimulator (ICOS) or CRP1 (CD28-related protein-1), is a member of the growing CD28 family of immune costimulatory receptors. Other family members are CD28, CTLA-4 and PD-1. ICOS is expressed on most CD45RO+ cells. ICOS expression is upregulated within approximately 24-48 hours of activation on Th primed cells. B7-H2, a member of the B7 family of costimulatory ligands, has been identified as the ICOS ligand. The B7-H2/ICOS interaction appears to play roles in T cell dependent B cell activation and Th differentiation.