Anti-Cyclin E2 Rabbit Polyclonal Antibody
ANTIA10048-100
New Product
- Antibody type:Primary
- Antigen name:G1/S specific cyclin E2
- Antigen symbol:Cyclin E2
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Western blot:Yes
- Environmentally Preferable:
- Form:Liquid
- Gene ID:UniprotID# O96020
- Antigen synonyms:CCNE 2|CyclinE2|CYCE2|CYCE 2|CCNE2 protein|CCN E2|CYC E2|Cyclin E2|CCNE2
- Storage buffer:Supplied in Phosphate Buffered Saline, pH 7,3, with 50% Glycerol and 0,02% Sodium Azide
- Molecular weight:47 kDa
- Sequence:ALKDAPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILTAAALCHFTSIEVVKKASGLEWDSISECVDWMVPFVNVVKSTSPVKLKTFKKIPMEDRHNIQTHTNYLAMLEEVNYINTFRKGGQLSPVCNGGIMTPPKSTEKPPGKH
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 255 - 404 of human Cyclin E2 (NP_477097.1)
- Tested applications:ICC/IF
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit polyclonal antibody to Cyclin E2 for WB and ICC/IF with samples derived from human.
- Validated Applications: WB, ICC/IF
- Recommended Dilutions: WB: 1:500 to 1:2000, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: Cyclin E2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human