Anti-HSD3B1 Rabbit Monoclonal Antibody [clone: ARC2437]
ANTIA308449-100
New Product
- Antibody type:Primary
- Antigen name:3 beta and steroid delta isomerase 1
- Antigen symbol:HSD3B1
- Clonality:Monoclonal
- Clone:ARC2437
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P14060
- Antigen synonyms:3-beta-hydroxy-5-ene steroid dehydrogenase|3BHS1_HUMAN|3BETAHSD|3 beta HSD I|3 beta-hydroxysteroid dehydrogenase/Delta 5-->|3-beta-HSD I|3 beta and steroid hydroxy delta 5 steroid dehydrogenase|3BH|4-isomerase type I
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:42 kDa
- Sequence:RGQFYYISDDTPHQSYDNLNYTLSKEFGLRLDSRWSFPLSLMYWIGFLLEIVSFLLRPIYTYRPPFNRHIVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAK
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 250-350 of human HSD3B1 (P14060)
- Tested applications:IHC
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit monoclonal [ARC2437] antibody to HSD3B1 for WB and IHC with samples derived from human, mouse and rat.
- Validated applications: WB, IHC
- Recommended dilutions: WB: 1:500 to 1:1,000, IHC: 1:50 to 1:200
Type: Primary
Antigen: HSD3B1
Clonality: Monoclonal
Clone: ARC2437
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat