Anti-MAT2A Rabbit Monoclonal Antibody [clone: ARC2447]
ANTIA307555-100
New Product
- Antibody type:Primary
- Antigen name:AdoMet synthase 2
- Antigen symbol:MAT2A
- Clonality:Monoclonal
- Clone:ARC2447
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P31153
- Antigen synonyms:MAT 2A|MAT 2|MAT2A|MAT-II|AMS2|AdoMet synthetase|MAT II|AMS 2|AdoMet synthetase 2
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:50 kDa
- Sequence:MNGQLNGFHEAFIEEGTFLFTSESVGEGHPDKICDQISDAVLDAHLQQDPDAKVACETVAKTGMILLAGEITSRAAVDYQKVVREAVKHIGYDDSSKGFD
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MAT2A (P31153)
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit monoclonal [ARC2447] antibody to MAT2A for WB with samples derived from Human, Mouse and Rat.
- Validated Applications: WB
- Recommended Dilutions: WB: 1:1000 to 1:5000
Type: Primary
Antigen: MAT2A
Clonality: Monoclonal
Clone: ARC2447
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat