Anti-cGAS Rabbit Polyclonal Antibody
ANTIA16161-100
New Product
- Antibody type:Primary
- Antigen name:C6orf150
- Antigen symbol:cGAS
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q8N884
- Antigen synonyms:CGAS_HUMAN|cGAMP synthase|Chromosome 6 open reading frame 150|cGAS|Mab 21 domain containing 1|Cyclic GMP-AMP synthase|cGMP Synthase|Hypothetical protein LOC115004|h-cGAS
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% Glycerol and 0,02% Sodium Azide
- Molecular weight:62 kDa
- Sequence:KEEKCCRKDCLKLMKYLLEQLKERFKDKKHLDKFSSYHVKTAFFHVCTQNPQDSQWDRKDLGLCFDNCVTYFLQCLRTEKLENYFIPEFNLFSSNLIDKRSKEFLTKQIEYERNNEFPVFDEF
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at ‒20 °C. Avoid freeze / thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 400-522 of human cGAS (NP_612450.2)
- Tested applications:IHC, ICC/IF
- Purification:Affinity purification.
- Pack type:Plastic vial
- Pk:100 µl
Rabbit polyclonal antibody to cGAS for WB, IHC and ICC/IF with samples derived from human, mouse and rat.
- Validated applications: WB, IHC, ICC/IF
- Recommended dilutions: WB: 1:500 to 1:1000, IHC: 1:50 to 1:200, ICC/IF: 1:50 to 1:20
Type: Primary
Antigen: cGAS
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat