Anti-Angiotensin Converting Enzyme 1 Rabbit Polyclonal Antibody
Catalog # ANTIA11567-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Antibody type:Primary
- Antigen name:ACE
- Antigen symbol:Angiotensin Converting Enzyme 1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Environmentally Preferable:
- Form:Liquid
- Gene ID:UniprotID# P12821
- Antigen synonyms:Angiotensin I converting enzyme 1|_HUMAN|Angiotensin Converting Enzyme 1|Angiotensin I converting enzyme|Angiotensin converting enzyme somatic isoform|T|1|Angiotensin converting enzyme testis specific isoform
- Storage buffer:Supplied in Phosphate Buffered Saline, pH 7,3, with 50% Glycerol and 0,01% Thiomersal
- Molecular weight:170 kDa
- Sequence:LHQCDIYRSTKAGAKLRKVLQAGSSRPWQEVLKDMVGLDALDAQPLLKYFQPVTQWLQEQNQQNGEVLGWPEYQWHPPLPDNYPEGIDLVTDEAEASKFVEEYDRTSQVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARKFDVNQLQNTTIKRIIKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCH
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 554 - 758 of human ACE11 (NP_000780.1)
- Tested applications:IHC
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody to Angiotensin Converting Enzyme 1 for WB and IHC with samples derived from human, mouse and rat.
- Validated applications: WB, IHC
- Recommended dilutions: WB: 1:500 to 1:1000, IHC: 1:50 to 1:200
Type: Primary
Antigen: Angiotensin Converting Enzyme 1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat