Anti-SGLT2/SLC5A2 Rabbit Polyclonal Antibody
Catalog # NOVUNBP1-92384
Supplier: Novus Biologicals
New Product
Specifications
- Antibody type:Primary
- Antigen symbol:SGLT2/SLC5A2
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- ImmunoFluorescence:Yes
- Isotype:IgG
- Reactivity:Human
- Western blot:Yes
- Gene ID:6524
- Antigen synonyms:solute carrier family 5 (sodium/glucose transporter)|solute carrier family 5 (sodium/glucose cotransporter)|Na(+)/glucose cotransporter 2|member 2|Low affinity sodium-glucose cotransporter|Solute carrier family 5 member 2|SGLT2sodium/glucose cotransporter 2
- Storage buffer:PBS (pH 7,2) and 40% Glycerol
- Storage temperature:Store at +4 °C short term. Aliquot and store at −20 °C long term. Avoid freeze-thaw cycles.
- Immunogen:This antibody was developed against Recombinant Protein corresponding to amino acids:FHEVGGYSGLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLL.
- Purification:Immunogen affinity purified
- Pk:0,1 mL
Specifications
About this item
The SGLT2 / SLC5A2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SGLT2 / SLC5A2. This antibody reacts with human. The SGLT2 / SLC5A2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Type: Primary
Antigen: SGLT2/SLC5A2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human