Human Recombinant IL-35 (from HEK293 cells)
Interleukin 35 (IL-35) is a member of the IL-12 cytokine family and is produced by regulatory T cells (Tregs). IL-35 is a heterodimeric cytokine that is comprised of the p35 subunit (IL-12A) and the Epstein-Barr virus induced gene 3 subunit (EBI3/IL-27B). IL-35 binds the IL-12Rbeta2/gp130 hetero- and homodimers to activate STAT1 and STAT4 signaling. IL-35 functions as a suppressor of immune cell inflammatory responses.
- High quality
- Low endotoxin
- Affordable
: For research use only.
- Conjugation:Unconjugated
- Protein function:Cytokine
- Protein/peptide type:Recombinant
- Source:E. coli
- Species:Human
- Storage conditions:–20 °C
- Endotoxin content:Endotoxin LAL (EU/µg) ≤5
- Biological activity:Bioactivity Assay: NA, ED₅₀ ≤NA, Bioactivity ≥NA
- Gene ID:Q14213/P29459
- Reconstitution instructions:Sterile water at 0,1 mg/ml
- Endotoxin-free:N
- Carrier-free:Y
- Protease-free:N
- Animal-free:N
- Protein/peptide name:IL-35
- Purity:≥95%
- Molecular weight:45,8/ 60 - 65 unreduced 70 - 80 reduced kDa
- Sequence:EBI3:RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK p35:RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
- Endotoxin level:Low
- Formulation:10 mM Sodium phosphate, 30 mM Sodium chloride, pH7,5
- Nuclease-free:N
- Grade:RUO
- Shipping temperature:RT
Frequently Bought Together