Anti-PPAPDC2 Rabbit Polyclonal Antibody
ABNOPAB21010
: Abnova
- Antibody type:Primary
- Antigen name:Phosphatidic Acid Phosphatase Type 2 Domain Containing 2
- Antigen symbol:PPAPDC2
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Western blot:Yes
- Cross adsorption:No
- Format:Liquid
- Gene ID:403313
- Antigen synonyms:Phosphatidic acid phosphatase type 2 domain-containing protein 2|PSDP|Presqualene diphosphate phosphatase|PDP1|bA6J24.6|PPAPDC2|PPAP2 domain-containing protein 2
- Storage buffer:PBS, pH 7,5 (40% glycerol, 0,02% sodium azide)
- Sequence:PAHNQMDMFVTLSVDKYSFPSGHATRAALMSR
- Storage temperature:Store at 4 °C. For long term storage store at –20 °C. Aliquot to avoid repeated freezing and thawing.
- Immunogen:Recombinant protein corresponding to amino acids of human PPAPDC2.
- Purification:Antigen affinity purification
- Size:100 μl
- Pk:100 µl
Rabbit polyclonal antibody raised against recombinant PPAPDC2.
Recommended Dilutions: Immunohistochemistry: 1:50-1:200; Western Blot: 1:250-1:500
Type: Primary
Antigen: PPAPDC2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human