Human recombinant IL6 (fromE. coli)
Supplier: BIORBYT
Certificates
About this item
Specifications
- Conjugation:Unconjugated
- Protein/peptide type:Recombinant
- Source:E. coli
- Species:Human
- Storage conditions:Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
- Biological activity:Recombinant IL6 is fully biologically active when compared to standards.
ED50 is less than 0.1 ng/ml as determined by the dosedependent stimulation of human TF1 cells.
Specific Activity of 5.0 x 107 IU/mg. - Protein synonyms:Interleukin BSF 2
- UniProtKB:P05231 (Human)
- Protein/peptide name:IL6
- Purity:>95% as determined by reducing SDS-PAGE.
- Sequence:PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLP KMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKA KNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
- Formulation:Lyophilized from a 0.2 um filtered solution of 20mM HAc-NaAc, 150mM NaCl, pH 5.0.
- Tested applications:SDS-PAGE , FuncS
Specifications
Frequently Bought Together