Anti-CDK5 Mouse Monoclonal Antibody [clone: 1321CT281.130.129]
Catalog # ABGEAM8417B
Supplier: ABGENT
Specifications
- Antibody type:Primary
- Antigen name:cyclin-dependent kinase 5
- Antigen symbol:CDK5
- Clonality:Monoclonal
- Clone:1321CT281.130.129
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG1 kappa
- Reactivity:Human,Rat
- Western blot:Yes
- Gene ID:1020
- Antigen synonyms:PSSALRE|LIS7
- Storage buffer:pH 7,4
- Molecular weight:33.304 kDa
- Sequence:AEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYF
- Storage temperature:Maintain refrigerated at 2-8 °C for up to 6 months. For long term storage store at –20 °C in small aliquots to prevent freeze-thaw cycles
- Concentration:1.450
- Shipping temperature:4 °C
- Immunogen:This antibody is generated from a mouse immunized with a recombinant protein from human.
- Purification:Protein G Purification
- Pk:400 µl
Specifications
About this item
Type: Primary
Antigen: CDK5
Clonality: Monoclonal
Clone: 1321CT281.130.129
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG1 kappa
Reactivity: Human, Rat