Anti-RUNX1 Mouse Monoclonal Antibody [clone: 1B4]
Catalog # ABNOH00000861-M19
Supplier: ABNOVA
Specifications
- Antibody type:Primary
- Antigen name:Runt-related Transcription Factor 1
- Antigen symbol:RUNX1
- Clonality:Monoclonal
- Clone:1B4
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG2a kappa
- Reactivity:Human
- Western blot:Yes
- Cross adsorption:No
- Format:Liquid
- Gene ID:861
- Antigen synonyms:CBFA2|SL3-3 enhancer factor 1 alpha B subunit|PEA2-alpha B|SL3/AKV core-binding factor alpha B subunit|PEBP2-alpha B|RUNX1|Core-binding factor subunit alpha-2|Polyomavirus enhancer-binding protein 2 alpha B subunit|AML1|Oncogene AML-1|CBF-alpha-2|Acute myeloid leukemia 1 protein
- Amino acid number:376 to 480
- Storage buffer:1x PBS, pH 7,4
- Sequence:RYHTYLPPPYPGSSQAQGGPFQASSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCTNASTGSALLNPSLPNQSDVVEAEGSHSNSPTNMAPSARLEEAVWRPY
- Storage temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:RUNX1 (NP_001745, 376 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Size:100 µg
- Pk:100 µg
Specifications
About this item
Mouse monoclonal antibody raised against a partial recombinant RUNX1.
Recommended Dilutions: Western Blot: 1-5 ?g/ml
Type: Primary
Antigen: RUNX1
Clonality: Monoclonal
Clone: 1B4
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2a kappa
Reactivity: Human