Anti-PCNA Rabbit Polyclonal Antibody
Catalog # ANTIA12584-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Antibody type:Primary
- Antigen name:ATLD2
- Antigen symbol:PCNA
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:African green monkey,Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P12004
- Antigen synonyms:DNA polymerase delta auxiliary protein|Mutagen-sensitive 209 protein|etID36690.10|HGCN8729|MGC8367|cb16|fa28e03|fb36g03|Cyclin
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% Glycerol and 0,05% Proclin 300
- Molecular weight:34 kDa
- Sequence:CAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at ‒20 °C. Avoid freeze / thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 162-261 of human PCNA (NP_002583.1)
- Purification:Affinity purification.
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit polyclonal antibody to PCNA for WB with samples derived from human, Mouse, Rat and African green monkey.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:200
Type: Primary
Antigen: PCNA
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat;African green monkey