Human recombinant PTH 184 (from E. coli)
Supplier: Biorbyt
Certificates
About this item
Specifications
- Conjugation:Unconjugated
- Protein/peptide type:Recombinant
- Source:E. coli
- Species:Human
- Storage conditions:Store at −20 °C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 °C for 2-7 days. Aliquots of reconstituted samples are stable at −20 °C for 3 months.
- Biological activity:Recombinant PTH is fully biologically active when compared to standards.
Specific Activity of 1.0 x 104 IU/mg as calculated by the UMR106 cell/cAMP method. - Protein synonyms:Parathyrin|PTH1 receptor|PTHY_protein.|PTH1|Parathyroid hormone 1|Parathormone|hPTH|PTHR1|PTHR|PTH|Parathyroid hormone|PTH1R
- UniProtKB:P01270 (Human)
- Protein/peptide name:PTH 184
- Purity:>95% as determined by reducing SDS-PAGE.
- Sequence:SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEK SLGEADKADVNVLTKAKSQ
- Formulation:Lyophilized from a 0.2 um filtered solution of 10mM HAc-NaAc, 150mM NaCl, 5% Mannitol, pH 4.0.
- Tested applications:SDS-PAGE , FuncS
Specifications
Frequently Bought Together