Anti-MZF1 Mouse Monoclonal Antibody [clone: 1F7]
Catalog # ABNOH00007593-M04
Supplier: Abnova
Specifications
- Antibody type:Primary
- Antigen name:Myeloid zinc finger 1
- Antigen symbol:MZF1
- Clonality:Monoclonal
- Clone:1F7
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- ImmunoFluorescence:Yes
- Isotype:IgG1 kappa
- Reactivity:Human
- Western blot:Yes
- Cross adsorption:No
- Form:Liquid
- Gene ID:7593
- Antigen synonyms:ZFP98|MZF1B|ZNF42|MZF-1|ZSCAN6
- Storage buffer:In 1x PBS, pH 7,4
- Sequence:QGFVRSARLEEHRRVHTGEQPFRCAECGQSFRQRSNLLQHQRIHGDPPGPGAKPPAPPGAPEPPGPFPCSECRESFARRAVLLEHQAVHTGDKSFGCVEC
- Storage temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Shipping temperature:Ice
- Immunogen:MZF1 (NP_003413, 419 a.a. ~ 518 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Size:100 µg
- Pk:100 µg
Specifications
About this item
Mouse monoclonal antibody raised against a partial recombinant MZF1.
Recommended Dilutions: Western Blot (1 - 5 µg/ml)
Type: Primary
Antigen: MZF1
Clonality: Monoclonal
Clone: 1F7
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG1 kappa
Reactivity: Human