Anti-ELK1 Rabbit Polyclonal Antibody
ANTIA12697-100
New Product
- Antikroppstyp:Primär
- Antikroppsnamn:ELK 1
- Antigensymbol:ELK1
- Klonalitet:Polyclonal
- Konjugation:Unconjugated
- Värd:Rabbit
- Isotyp:IgG
- Reaktivitet:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gen-ID:UniprotID# P19419
- Antigen synonymer:ETS domain containing protein Elk1|ELK1|ELK1_HUMAN|ELK1, ETS transcription factor|ELK1 protein|ELK2 member of ETS oncogene family|ELK1 member of ETS oncogene family|ETS domain containing protein Elk 1|ETS domain protein Elk1
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% Glycerol and 0,05% Proclin 300
- Molekylvikt:62 kDa
- Sequence:PSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGLGRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQA
- Förvaringstemperatur:Shipped at 4 °C. Upon delivery aliquot and store at ‒20 °C. Avoid freeze / thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 201-297 of human ELK1 (NP_005220.2)
- Rening:Affinity purification.
- Förpackningstyp:Plastic vial
- Förp.:100 µl
Rabbit polyclonal antibody to ELK1 for WB with samples derived from human, mouse and rat.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:100
Type: Primary
Antigen: ELK1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat