Anti-FBXO16 Rabbit Polyclonal Antibody
Katalog # NOVUNBP1-57614
Leverantör: Novus Biologicals
Specifikationer
- Antikroppstyp:Primär
- Antikroppsnamn:F-Box Protein 16
- Antigensymbol:FBXO16
- Klonalitet:Polyclonal
- Konjugation:Unconjugated
- Värd:Rabbit
- Isotyp:IgG
- Reaktivitet:Human
- Western blot:Yes
- Gen-ID:157574
- Antigen synonymer:F-box protein 16|MGC125923|FBX16MGC125925|F-box only protein 16|MGC125924
- Storage buffer:PBS and 2% Sucrose
- Förvaringstemperatur:Store at -20 °C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to FBXO16(F-box protein 16) The peptide sequence was selected from the N terminal of FBXO16. Peptide sequence CRKLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSLCRCAQVCWHWKNLA.
- Rening:Immunogen affinity purified
- Storlek:100 μl
- Förp.:100 µl
Specifikationer
Om denna produkt
The FBXO16 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FBXO16. This antibody reacts with human. The FBXO16 Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: FBXO16
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human