Specifikationer
- Antikroppstyp:Primär
- Antikroppsnamn:Phospholamban
- Antigensymbol:PLN
- Klonalitet:Polyclonal
- Värd:Rabbit
- Isotyp:IgG
- Reaktivitet:Human,Rat,Mouse
- Western blot:Yes
- Form:Lyophilized
- Gen-ID:5350
- Antigen synonymer:CMH18|CMD1P|PLB
- UniProtKB:P26678
- Förvaringstemperatur:At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
- Immunogen:A synthetic peptide corresponding to a sequence at the N-terminus of human PLN(1-35aa MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINF), different from the related mouse and rat sequences by one amino acid.
- Rening:Immunogen affinity purified.
- Storlek:100 µg/vial
- Förp.:100 µG
Specifikationer
Om denna produkt
Rabbit IgG polyclonal antibody for Cardiac phospholamban(PLN) detection. Tested with WB in Human;Mouse;Rat.
Phospholamban is a 52 amino acid integral membrane protein that regulates the Ca2+ pump in cardiac muscle and skeletal muscle cells. The subsequent activation of the Ca(2+) pump leads to enhanced muscle relaxation rates, thereby contributing to the inotropic response elicited in heart by beta-agonists. Phospholamban is also expressed in slow-twitch skeletal muscle and some smooth muscle cells. It is observed that human ventricle and quadriceps displayed high levels of phospholamban transcripts and proteins, with markedly lower expression observed in smooth muscles, while the right atrium also expressed low levels of phospholamban. The structure of the human phospholamban gene closely resembles that reported for chicken, rabbit, rat, and mouse. Comparison of the human to other mammalian phospholamban genes indicated a marked conservation of sequence for at least 217 bp upstream of the transcription start site.
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
WB: The detection limit for PLN is approximately 0.1ng/lane under reducing conditions.
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Type: Primary
Antigen: PPP3CA
Clonality: Polyclonal
Clone:
Conjugation:
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human