Anti-Pit1 Rabbit Polyclonal Antibody
ANTIA93298-100
New Product
- Antibody type:Primary
- Antigen name:GHF 1A
- Antigen symbol:Pit1
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P28069
- Antigen synonyms:GHF-1|Pit 1|Hmp 1|GHF1A|Hmp1|Dwarf|GHF1|Growth hormone factor 1
- Storage buffer:Supplied in Phosphate Buffered Saline, pH 7,3, with 50% Glycerol and 0,01% Thiomersal
- Molecular weight:35 kDa
- Sequence:LTPCLYKFPDHTLSHGFPPIHQPLLAEDPTAADFKQELRRKSKLVEEPIDMDSPEIRELEKFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLKAILSKWLEEAEQVGALYNEKVGANERKRKRRTTISIAAKDALERHFGEQNKPSSQEI
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 100-270 of human POU1F1 (NP_001116229)
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit polyclonal antibody to Pit1 for WB with samples derived from Human.
- Validated applications: WB
- Recommended dilutions: WB: 1:100 to 1:500
Type: Primary
Antigen: Pit1
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human