Anti-SynGAP Rabbit Monoclonal Antibody [clone: ARC2183]
Katalog # ANTIA308630-100
Leverantör: ANTIBODIES.COM
New Product
Specifikationer
- Antibody type:Primary
- Antigen name:DKFZp761G1421
- Antigen symbol:SynGAP
- Clonality:Monoclonal
- Clone:ARC2183
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q96PV0
- Antigen synonyms:Ras GTPase-activating protein SynGAP|MRD5|Neuronal RasGAP|OTTHUMP00000064825|p135 SynGAP|Ras GTPase activating protein SynGAP|RASA 1|KIAA1938|RASA 5
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:140 kDa
- Sequence:SEKRLRQQQAEKDSQIKSIIGRLMLVEEELRRDHPAMAEPLPEPKKRLLDAQERQLPPLGPTNPRVTLAPPWNGLAPPAPPPPPRLQITENGEFRNTADH
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 1244-1343 of human SynGAP (Q96PV0)
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifikationer
Om denna produkt
Rabbit monoclonal [ARC2183] antibody to SynGAP for WB with samples derived from human, mouse and rat.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:2,000
Type: Primary
Antigen: SynGAP
Clonality: Monoclonal
Clone: ARC2183
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat