Anti-PDHB Rabbit Monoclonal Antibody [clone: ARC1074]
Catalog # ANTIA306144-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Antibody type:Primary
- Antigen name:DKFZp564K0164
- Antigen symbol:PDHB
- Clonality:Monoclonal
- Clone:ARC1074
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P11177
- Antigen synonyms:Pyruvate dehydrogenase E1 beta polypeptide|PDHE1-B|pdhB|mitochondrial|PDHBD|ODPB_HUMAN|Pyruvate dehydrogenase (lipoamide) beta|PDHE1 B|PHE1B
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:34 kDa
- Sequence:GVECEVINMRTIRPMDMETIEASVMKTNHLVTVEGGWPQFGVGAEICARIMEGPAFNFLDAPAVRVTGADVPMPYAKILEDNSIPQVKDIIFAIKKTLNI
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 260-359 of human Pyruvate Dehydrogenase E1 beta subunit (P11177).
- Tested applications:IHC
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC1074] antibody to PDHB for WB and IHC with samples derived from Human, Mouse and Rat.
- Validated Applications: WB, IHC
- Recommended Dilutions: WB: 1:500 to 1:2000, IHC: 1:50 to 1:200
Type: Primary
Antigen: PDHB
Clonality: Monoclonal
Clone: ARC1074
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human;Mouse;Rat