Anti-CD11a Rabbit Monoclonal Antibody [clone: ARC0344]
Catalog # ANTIA308023-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Antibody type:Primary
- Antigen name:Antigen CD11A
- Antigen symbol:CD11a
- Clonality:Monoclonal
- Clone:ARC0344
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P20701
- Antigen synonyms:CD 11a|CD11a antigen|alpha polypeptide)|Integrin, alpha L (antigen CD11A (p180), lymphocyte function associated antigen 1|Integrin gene promoter|Antigen CD11A (p180), lymphocyte function associated antigen 1, alpha polypeptide|Integrin alpha-L|CD11 antigen-like family member A|Integrin Alpha L
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:180 kDa
- Sequence:NASLAQVVMKVDVVYEKQMLYLYVLSGIGGLLLLLLIFIVLYKVGFFKRNLKEKMEAGRGVPNGIPAEDSEQLASGQEAGDPGCLKPLHEKDSESGGGKD
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 1071-1170 of human CD11a/LFA-1A/ITGAL (P20701)
- Tested applications:IHC
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC0344] antibody to CD11a for WB and IHC with samples derived from Human.
- Validated Applications: WB, IHC
- Recommended Dilutions: WB: 1:500 to 1:2000, IHC: 1:50 to 1:200
Type: Primary
Antigen: CD11a
Clonality: Monoclonal
Clone: ARC0344
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human