Anti-Hyaluronan synthase 2 Rabbit Polyclonal Antibody
ANTIA12414-100
New Product
- Antibody type:Primary
- Antigen name:HA synthase 2
- Antigen symbol:Hyaluronan synthase 2
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q92819
- Antigen synonyms:Hyaluronic acid synthase 2|Hyaluronan synthase 2|Hyaluronate synthase 2|has2|HAS2_HUMAN
- Storage buffer:Supplied in Phosphate buffered saline, pH 7,3, with 50% Glycerol and 0,02% Sodium Azide
- Molecular weight:64 kDa
- Sequence:EHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSEDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETDESHKESSQHVTQLVLSNKSICIMQ
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at ‒20 °C. Avoid freeze / thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 67-185 of human HAS2 (NP_005319.1)
- Purification:Affinity purification.
- Pack type:Plastic vial
- Pk:100 µl
Rabbit polyclonal antibody to Hyaluronan synthase 2 for WB with samples derived from mouse and rat.
- Validated applications: WB
- Recommended dilutions: WB: 1:100 to 1:50
Type: Primary
Antigen: Hyaluronan synthase 2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Mouse;Rat