Anti-Guanylate kinase Rabbit Polyclonal Antibody
ANTIA10484-100
New Product
- Antibody type:Primary
- Antigen name:ATP:GMP phosphotransferase
- Antigen symbol:Guanylate kinase
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q16774
- Antigen synonyms:GMP kinase|GUK1|Guanylate kinase|FLJ42686|GMK|FLJ43710|KGUA_HUMAN
- Storage buffer:Supplied in Phosphate Buffered Saline, pH 7,3, with 50% Glycerol and 0,02% Sodium Azide
- Molecular weight:21 kDa
- Sequence:MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at –20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1 - 197 of human GUK1 (NP_000849.1)
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Rabbit polyclonal antibody to Guanylate kinase for WB with samples derived from human.
- Validated applications: WB
- Recommended dilutions: WB: 1:200 to 1:1000
Type: Primary
Antigen: Guanylate kinase
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human