Anti-CAMKIV Rabbit Monoclonal Antibody [Clone: ARC1506]
Catalog # ANTIA305710-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Antibody type:Primary
- Antigen name:Brain Ca(2+) calmodulin dependent protein kinase type 4
- Antigen symbol:CAMKIV
- Clonality:Monoclonal
- Clone:ARC1506
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# Q16566
- Antigen synonyms:Brain Ca(2+) calmodulin dependent protein kinase type IV|CAM kinase GR|Calcium / calmodulin dependent protein kinase type 4 catalytic chain|Calcium / calmodulin dependent protein kinase type IV catalytic chain|Brain Ca++-calmodulin dependent protein kinase type IV|Calcium/calmodulin dependent protein kinase type IV|Calcium/calmodulin-dependent protein kinase type IV|CAM kinase 4|Calcium/calmodulin dependent protein kinase IV
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:60 kDa
- Sequence:EGEKIQGDGAQAAVKGAQAELMKVQALEKVKGADINAEEAPKMVPKAVEDGIKVADLELEEGLAEEKLKTVEEAAAPREGQGSSAVGFEVPQQDVILPEY
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 374 - 473 of human CAMKIV (Q16566).
- Tested applications:IHC, ICC/IF
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC1506] antibody to CAMKIV for WB, IHC and ICC/IF with samples derived from human, mouse and rat.
- Validated applications: WB, IHC, ICC/IF
- Recommended dilutions: WB: 1:500 to 1:1000, IHC: 1:50 to 1:200, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: CAMKIV
Clonality: Monoclonal
Clone: ARC1506
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat