Anti-OSCP Rabbit Polyclonal Antibody
Katalog # ANTIA305529-100
Leverantör: ANTIBODIES.COM
New Product
Specifikationer
- Antibody type:Primary
- Antigen name:B930011D01Rik
- Antigen symbol:OSCP
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# O95965
- Antigen synonyms:TIED|ITGBL1|Ten integrin EGF like repeat domain protein|OSCP|MGC99074|Osteoblast specific cysteine rich protein
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol and 0,01% thiomersal
- Molecular weight:54 kDa
- Sequence:CYCGNCYCKAGWHGDKCEFQCDITPWESKRRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCD
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 200 - 300 of human ITGBL1 (NP_004782.1).
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifikationer
Om denna produkt
Rabbit polyclonal antibody to OSCP for WB with samples derived from human, mouse and rat.
- Validated applications: WB
- Recommended dilutions: WB: 1:500 to 1:2000
Type: Primary
Antigen: OSCP
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat