Anti-XPD Rabbit Monoclonal Antibody [Clone: ARC2401]
Catalog # ANTIA305413-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Antibody type:Primary
- Antigen name:Basic transcription factor 2 80 kDa subunit
- Antigen symbol:XPD
- Clonality:Monoclonal
- Clone:ARC2401
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# P18074
- Antigen synonyms:DNA repair protein complementing XP-D cells|COFS 2|DNA excision repair protein ERCC 2|BTF2 p80|DNA excision repair protein ERCC-2|CXPD|COFS2|EM9|DNA repair protein complementing XP D cells
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:80 kDa
- Sequence:ARGKVSEGIDFVHHYGRAVIMFGVPYVYTQSRILKARLEYLRDQFQIRENDFLTFDAMRHAAQCVGRAIRGKTDYGLMVFADKRFARGDKRGKLPRWIQEH
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 600 - 700 of human XPD/ERCC2 (P18074).
- Tested applications:IHC
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC2401] antibody to XPD for WB and IHC with samples derived from human, mouse and rat.
- Validated applications: WB, IHC
- Recommended dilutions: WB: 1:500 to 1:1000, IHC: 1:50 to 1:200
Type: Primary
Antigen: XPD
Clonality: Monoclonal
Clone: ARC2401
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat