Anti-SERCA1 ATPase Rabbit Monoclonal Antibody [Clone: ARC2207]
Catalog # ANTIA305365-100
Supplier: ANTIBODIES.COM
New Product
Specifications
- Antibody type:Primary
- Antigen name:AT2A1_HUMAN
- Antigen symbol:SERCA1 ATPase
- Clonality:Monoclonal
- Clone:ARC2207
- Conjugation:Unconjugated
- Host:Rabbit
- ImmunoChemistry:Yes
- Isotype:IgG
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Form:Liquid
- Gene ID:UniprotID# O14983
- Antigen synonyms:ATP2A1|EC 3.6.3.8|ATPase, Ca(2+)-transporting fast twitch 1|ATP2A|Calcium transporting ATPase sarcoplasmic reticulum type fast twitch skeletal muscle isoform|ATPase Ca++ transporting fast twitch 1|Calcium-transporting ATPase sarcoplasmic reticulum type|ATPase Ca++ transporting cardiac muscle fast twitch 1|Calcium pump 1
- Storage buffer:Supplied in phosphate buffered saline, pH 7,3, with 50% glycerol, 0,05% BSA, and 0,02% sodium azide
- Molecular weight:110 kDa
- Sequence:ALSVLVTIEMCNALNSLSENQSLLRMPPWVNIWLLGSICLSMSLHFLILYVDPLPMIFKLRALDLTQWLMVLKISLPVIGLDEILKFVARNYLEDPEDERRK
- Storage temperature:Shipped at 4 °C. Upon delivery aliquot and store at −20 °C. Avoid freeze/thaw cycles.
- Shipping temperature:Shipped on blue ice at 4 °C
- Immunogen:A synthetic peptide corresponding to a sequence within amino acids 900 - 1001 of human SERCA1/ATP2A1 (O14983).
- Tested applications:ICC/IF
- Purification:Affinity purification
- Pack type:Plastic vial
- Pk:100 µl
Specifications
About this item
Rabbit monoclonal [ARC2207] antibody to SERCA1 ATPase for WB and ICC/IF with samples derived from human, mouse and rat.
- Validated applications: WB, ICC/IF
- Recommended dilutions: WB: 1:500 to 1:2000, ICC/IF: 1:50 to 1:200
Type: Primary
Antigen: SERCA1 ATPase
Clonality: Monoclonal
Clone: ARC2207
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse, Rat