Anti-FBXO16 Rabbit Polyclonal Antibody
NOVUNBP1-57614
- Antibody type:Primary
- Antigen name:F-Box Protein 16
- Antigen symbol:FBXO16
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human
- Western blot:Yes
- Gene ID:157574
- Antigen synonyms:F-box protein 16|MGC125923|FBX16MGC125925|F-box only protein 16|MGC125924
- Storage buffer:PBS and 2% Sucrose
- Storage temperature:Store at -20 °C. Avoid freeze-thaw cycles.
- Immunogen:Synthetic peptides corresponding to FBXO16(F-box protein 16) The peptide sequence was selected from the N terminal of FBXO16. Peptide sequence CRKLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSLCRCAQVCWHWKNLA.
- Purification:Immunogen affinity purified
- Size:100 μl
- Pk:100 µl
The FBXO16 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FBXO16. This antibody reacts with human. The FBXO16 Antibody has been validated for the following applications: Western Blot.
Type: Primary
Antigen: FBXO16
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human