Specifications
- Antibody type:Primary
- Antigen name:argonaute RISC catalytic component 4
- Antigen symbol:AGO4
- Clonality:Polyclonal
- Conjugation:Unconjugated
- Host:Rabbit
- Isotype:IgG
- Reactivity:Human,Rat
- Western blot:Yes
- Cross adsorption:No
- Form:Lyophilized
- Gene ID:192670
- Antigen synonyms:EIF2C4
- Storage temperature:At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
- Immunogen:A synthetic peptide corresponding to a sequence at the N-terminus of human Argonaute 4 (114-153aa KDQTFKVSVQWVSVVSLQLLLEALAGHLNEVPDDSVQALD), identical to the related mouse sequence.
- Size:100 μg
- Pk:100 µG
Specifications
About this item
AGO4 (Argonaute 4) is also known as EIF2C4. This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic containing PAZ and PIWI domains, and it may play a role in short-interfering-RNA-mediated gene silencing. This gene is located on chromosome 1 in a cluster of closely related family members including argonaute 3, and eukaryotic translation initiation factor 2C, 1.
1. Carmell, M. A., Xuan, Z., Zhang, M. Q., Hannon, G. J. The argonaute family: tentacles that reach into RNAi, developmental control, stem cell maintenance, and tumorigenesis. Genes Dev. 16: 2733-2742, 2002.
2. Nagase, T., Kikuno, R., Nakayama, M., Hirosawa, M., Ohara, O. Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 7: 273-281, 2000.
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.