Anti-TRIM13 Mouse Monoclonal Antibody [clone: 1E5]
Catalog # ABNOH00010206-M02
Supplier: Abnova
Specifications
- Antibody type:Primary
- Antigen name:Tripartite Motif Containing 13
- Antigen symbol:TRIM13
- Clonality:Monoclonal
- Clone:1E5
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG1 kappa
- Reactivity:Human
- Western blot:Yes
- Cross adsorption:No
- Format:Liquid
- Gene ID:10206
- Antigen synonyms:LEU5|RFP2|RNF77|DLEU5|CAR
- Amino acid number:1 to 100
- Storage buffer:1x PBS, pH 7,4
- Sequence:MELLEEDLTCPICCSLFDDPRVLPCSHNFCKKCLEGILEGSVRNSLWRPAPFKCPTCRKETSATGINSLQVNYSLKGIVEKYNKIKISPKMPVCKGHLGQ
- Storage temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Immunogen:TRIM13 (NP_005789, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Size:100 µg
- Pk:100 µg
Specifications
About this item
Mouse monoclonal antibody raised against a partial recombinant TRIM13.
Recommended Dilutions: Western Blot: 1-5 ?g/ml
Type: Primary
Antigen: TRIM13
Clonality: Monoclonal
Clone: 1E5
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG1 kappa
Reactivity: Human