Anti-BCKDHB Rabbit Polyclonal Antibody
ABNOPAB22782
: Abnova
- Antikroppstyp:Primär
- Antikroppsnamn:branched chain keto acid dehydrogenase E1, beta polypeptide
- Antigensymbol:BCKDHB
- Klonalitet:Polyclonal
- Konjugation:Unconjugated
- Värd:Rabbit
- ImmunKemi:Yes
- Isotyp:IgG
- Reaktivitet:Human
- Western blot:Yes
- Korsad adsorption:No
- Mått:Liquid
- Gen-ID:594
- Antigen synonymer:E1B|dJ279A18.1
- Storage buffer:PBS, pH 7,5 (40% glycerol, 0,02% sodium azide)
- Sequence:QVAHFTFQPDPEPREYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRD
- Förvaringstemperatur:Store at 4 °C. For long term storage store at –20 °C. Aliquot to avoid repeated freezing and thawing.
- Immunogen:Recombinant protein corresponding to amino acids of human BCKDHB.
- Rening:Antigen affinity purification
- Storlek:100 μl
- Förp.:100 µl
Rabbit polyclonal antibody raised against recombinant BCKDHB.
Recommended Dilutions: Immunohistochemistry: 1:20-1:50; Western Blot: 1:250-1:500
Type: Primary
Antigen: BCKDHB
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human