Anti-YWHAZ Mouse Monoclonal Antibody [clone: 1314CT423.108.153.173.140]
Catalog # ABGEAM2256A
Supplier: Abgent
Specifications
- Antibody type:Primary
- Antigen name:tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta
- Antigen symbol:YWHAZ
- Clonality:Monoclonal
- Clone:1314CT423.108.153.173.140
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG2b kappa
- Reactivity:Human,Rat,Mouse
- Western blot:Yes
- Gene ID:7534
- Antigen synonyms:KCIP-1|HEL4|YWHAD|14-3-3-zeta|HEL-S-3
- Storage buffer:pH 7,4
- Molecular weight:27.745 kDa
- Sequence:MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWR
- Storage temperature:Maintain refrigerated at 2-8 °C for up to 6 months. For long term storage store at –20 °C in small aliquots to prevent freeze-thaw cycles
- Concentration:0.44
- Shipping temperature:4 °C
- Immunogen:This YWHAZ antibody is generated from a mouse immunized with a recombinant protein from human YWHAZ.
- Purification:Protein G Purification
- Pk:400 µl
Specifications
About this item
Type: Primary
Antigen: YWHAZ
Clonality: Monoclonal
Clone: 1314CT423.108.153.173.140
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2b kappa
Reactivity: Human, Mouse, Rat