Anti-Rapgef2 Rabbit Polyclonal Antibody
Catalog # ORIGTA329532
Supplier: OriGene
Specifications
- Antikroppstyp:Primär
- Antikroppsnamn:Rap guanine nucleotide exchange factor (GEF) 2
- Antigensymbol:RAPGEF2
- Klonalitet:Polyclonal
- Konjugation:Unconjugated
- Värd:Rabbit
- Isotyp:IgG
- Reaktivitet:Human,Mouse
- Western blot:Yes
- Korsad adsorption:No
- Form:Liquid
- Storage buffer:Lyophilized powder. Add 50 ul of distilled water. Final anti-Rapgef2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
- Molekylvikt:150 kDa
- Sequence:SILPQKPYNDIGIGQSQDDSIVGLRQTKHIPAALPVSGTLSSSNPDLLQS
- Förvaringstemperatur:–20 °C
- Shipping temperature:–20 °C
- Immunogen:The immunogen for anti-Rapgef2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SILPQKPYNDIGIGQSQDDSIVGLRQTKHIPAALPVSGTLSSSNPDLLQS
- Storlek:50 μg
- Förp.:50 µG
Specifications
About this item
Type: Primary
Antigen: Rapgef2
Clonality: Polyclonal
Clone:
Conjugation: Unconjugated
Epitope:
Host: Rabbit
Isotype: IgG
Reactivity: Human, Mouse