Anti-MPND Mouse Monoclonal Antibody [clone: 1C12]
Catalog # ABNOH00084954-M01
Supplier: Abnova
Specifications
- Antibody type:Primary
- Antigen name:MPN Domain Containing
- Antigen symbol:MPND
- Clonality:Monoclonal
- Clone:1C12
- Conjugation:Unconjugated
- ELISA:Yes
- Host:Mouse
- Isotype:IgG2b kappa
- Reactivity:Human
- Western blot:Yes
- Cross adsorption:No
- Form:Liquid
- Gene ID:84954
- Storage buffer:In 1X PBS, pH 7,4
- Sequence:ALLEPGAGVLSIYYLGKKFLGDLQPDGRIMWQETGQTFNSPSAWATHCKKLVNPAKKSGCGWASVKYKGQKLDKYKATWLRLHQLHTPATAADESPAS
- Storage temperature:Store at –20 °C or lower. Aliquot to avoid repeated freezing and thawing.
- Shipping temperature:Ice
- Immunogen:FLJ14981 (NP_116257, 84 a.a. ~ 181 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
- Size:100 µg
- Pk:100 µg
Specifications
About this item
Mouse monoclonal antibody raised against a partial recombinant FLJ14981.
Recommended Dilutons: Western Blot (1 to 5 µg/ml).
Type: Primary
Antigen: MPND
Clonality: Monoclonal
Clone: 1C12
Conjugation: Unconjugated
Epitope:
Host: Mouse
Isotype: IgG2b kappa
Reactivity: Human