108 Results for: "matrix modifier"

Supplier: Ricca Chemical

Palladium(II) nitrate 5000 ppm in nitric acid 1%, VeriSpec™ matrix modifier solution, for atomic absorption spectroscopy

Supplier: Ricca Chemical

Ammonium dihydrogen phosphate 20,000 ppm in nitric acid 1%, VeriSpec™ matrix modifier solution, for atomic absorption spectroscopy

Supplier: Thermo Scientific Chemicals

Matrix Modifier Solution

Supplier: ADVANCED BIOMATRIX, INC. MS

HyStem® Hydrogel Kit - The growth factor delivery matrix

Supplier: Cytiva

Capto Q ImpRes has a strong quarternary anion exchanger coupled to a chemically modified, high-flow agarose matrix.

Supplier: Cytiva

IMAC Sepharose 6 Fast Flow is composed of cross-linked 6% agarose beads modified with a novel chelating ligand immobilized to the base matrix.

Supplier: Prosci

ST6GALNAC5 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions.ST6GALNAC5 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions (Tsuchida et al., 2003 [PubMed 12668675]).

Supplier: Prosci

ST6GALNAC6 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions.ST6GALNAC6 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions (Tsuchida et al., 2003 [PubMed 12668675]).

Supplier: Prosci

Dermatopontin is an extracellular matrix protein with possible functions in cell-matrix interactions and matrix assembly. The protein is found in various tissues and many of its tyrosine residues are sulphated. Dermatopontin is postulated to modify the behavior of TGF-beta through interaction with decorin. [provided by RefSeq].

Supplier: ADVANCED BIOMATRIX, INC. MS

Heprasil® is a mixture of thiol-modified hyaluronic acid thiol-modified heparin. Heprasil® is a component of the HyStem®-HP kits, but can be purchased separately here.

Supplier: Cytiva

Chelating Sepharose Fast Flow is composed of cross-linked 6% agarose beads modified with iminodiacetic immobilized to the base matrix by stable ether linkages and sufficiently long spacer arms.

Supplier: Cytiva

SOURCE 30S is a synthetic high performance, preparative, chromatography medium, based on a 30 µm monosized, rigid polystyrene/divinyl benzene polymer matrix It is modified with sulphonate (S) strong cation exchange groups.

Supplier: Anaspec Inc

This peptide is des-gamma-carboxylated osteocalcin/bone Gla protein (BGP). Osteocalcin/BGP is the most abundant non-collagenous protein of the bone extracellular matrix and is secreted by osteoblasts. This des-gamma-carboxylated peptide serves as a substrate for vitamin K-dependent carboxylase, which modifies Glu17, Glu21, and Glu24 to Gla residues.
Sequence: YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge:C23-29)
MW: 5797.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: Rockland Immunochemical

CD44 was designed, produced, and validated as part of the Joy Cappel Young Investigator Award (JCYIA). CD44 is a receptor for hyaluronic acid (HA), an integral component of the extracellular matrix. CD44 mediates cell-cell and cell-matrix interactions through its affinity for HA, and can also interact with ligands such as osteopontin, collagens, and matrix metalloproteinases (MMPs). The multiple protein isoforms are encoded by a single gene by alternative splicing and are further modified by a range of post-translational modifications. CD44 function is controlled by these posttranslational modifications. The major physiological role of CD44 is to maintain organ and tissue structure via cell-cell and cell-matrix adhesion, but certain variant isoforms can also mediate lymphocyte activation and homing, and the presentation of chemical factors and hormones. CD44 participates in a wide variety of cellular functions including lymphocyte activation, recirculation and homing, hematopoiesis, and tumor metastasis. CD44 is a multi-structural and multi-functional cell surface molecule involved in cell proliferation, cell differentiation, cell migration, angiogenesis, presentation of cytokines, chemokines, and growth factors to the corresponding receptors, and docking of proteases at the cell membrane, as well as in signaling for cell survival. All these biological properties are essential to the physiological activities of normal cells, but they are also associated with the pathologic activities of cancer cells. CD44, particularly its variants, may be useful as a diagnostic or prognostic marker of malignancy and, in at least some human cancers, it may be a potential target for cancer therapy.

Supplier: Rockland Immunochemical

CD44 was designed, produced, and validated as part of the Joy Cappel Young Investigator Award (JCYIA). CD44 is a receptor for hyaluronic acid (HA), an integral component of the extracellular matrix. CD44 mediates cell-cell and cell-matrix interactions through its affinity for HA, and can also interact with ligands such as osteopontin, collagens, and matrix metalloproteinases (MMPs). The multiple protein isoforms are encoded by a single gene by alternative splicing and are further modified by a range of post-translational modifications. CD44 function is controlled by these posttranslational modifications. The major physiological role of CD44 is to maintain organ and tissue structure via cell-cell and cell-matrix adhesion, but certain variant isoforms can also mediate lymphocyte activation and homing, and the presentation of chemical factors and hormones. CD44 participates in a wide variety of cellular functions including lymphocyte activation, recirculation and homing, hematopoiesis, and tumor metastasis. CD44 is a multi-structural and multi-functional cell surface molecule involved in cell proliferation, cell differentiation, cell migration, angiogenesis, presentation of cytokines, chemokines, and growth factors to the corresponding receptors, and docking of proteases at the cell membrane, as well as in signaling for cell survival. All these biological properties are essential to the physiological activities of normal cells, but they are also associated with the pathologic activities of cancer cells. CD44, particularly its variants, may be useful as a diagnostic or prognostic marker of malignancy and, in at least some human cancers, it may be a potential target for cancer therapy.

Supplier: Genscript

GenScript offers recombinant protein A with non-essential domains removed, recombinant protein G with albumin binding site deleted as well as codon optimized protein L. By pre-coupling these genetically modified proteins to 4% highly cross-linked agarose, GenScrtipt developed excellent antibody affinity chromatography matrix - Protein A, G and L Resins for batch/gravity purification of polyclonal and monoclonal antibody from cell culture supernatants, serum, and ascites at both laboratory and larger scale. Besides, GenScript provides several affinity resins for convenient and reliable purification of tagged proteins, including His-tagged protein purification resin, GST fusion protein purification resin, DYKDDDDK tagged protein purification resin and Streptavidin resin.

Supplier: MP Biomedicals

Use of dextrans as long and hydrophilic spacer arms improves the performance of immobilized proteins acting on macromolecules. Dextrans are used in many applications as platelet aggregants, plasma volume extenders, osmotic pressure regulators, stabilizers, organ separation media, matrix components, copolymers, microcarriers, binding agents, viscosity modifiers, antithrombotics, lubricants and physical structure components. They may be used as long hydrophilic spacer arms to improve the performance (freedom of movement) of conjugated/bound proteins. Dextrans may be derivatized for use in biosensor systems.
Dextran is branched polysaccharide made up of linear α (1→6) linked glucose units and α (1→3) link initiated branches; it ranges in size from 10,000 to 150,000 Kd.Depending upon its molecular weight it has different uses in different fields.
Physical Appearance: White powder
Solubility: Very soluble in water (50 mg/mL), slightly soluble in alcohol

Supplier: PerkinElmer

MODIFIER-NH4H2PO4 MATRIX 100ML

Supplier: ADVANCED BIOMATRIX, INC. MS

HyStem®-C Hydrogel Kits - The starter matrix.

Supplier: ADVANCED BIOMATRIX, INC. MS

HyStem®-HP Hydrogel Kit - The growth factor delivery matrix

Supplier: StemBioSys

CELLvo™ Ostoeoarthritic Human Chondrocytes (50-70y) are primary, uncultured cells isolated from recently-diseased cadaver cartilage from donors between 50 and 70 years old. Osteoarthritis status is determined by macroscopic inspection using a modified Outerbridge (1960) scale. Cells are isolated by enzymatic digestion prior to cryopreservation.

Supplier: StemBioSys

CELLvo™ Healthy Human Chondrocytes (50-70y) are primary, uncultured cells isolated from recently-diseased cadaver cartilage from donors between 50 and 70 years old. Healthy status is determined by macroscopic inspection of the tissue using a modified outerbridge (1960) scale in order to distinguish healthy joints from those with signs of osteoarthritis. Cells are isolated by enzymatic digestion prior to cryopreservation.

Supplier: Rockland Immunochemical

Apoptosis is related to many diseases and development. Members in the Bcl-2 family are critical regulators of apoptosis by either inhibiting or promoting cell death. Bcl-2 homology 3 (BH3) domain is a potent death domain. BH3-only proteins, including Bad, Bid, Bik, Hrk, Bim, Noxa, and PUMA, form a growing subclass of the Bcl-2 family. A novel BH3-only protein was recently identified in human and mouse and designated Bmf (for Bcl-2-modifing factor). The BH3 domain in Bmf is required both for binding to Bcl-2 proteins and for triggering apoptosis. In healthy cells, Bmf associates with the dynein light chain 2 (DLC2) component of the myosin V motors and is sequestered by the cell's actin cytoskeleton. Disruption of the actin cytoskeleton, either by depolymerization of actin filaments or by detachment of cells from the extracellular matrix, triggers release and activation of Bmf, initiating the downstream apoptotic program. Bmf is constitutively expressed in many tissues.

Supplier: Rockland Immunochemical

Apoptosis is related to many diseases and development. Members in the Bcl-2 family are critical regulators of apoptosis by either inhibiting or promoting cell death. Bcl-2 homology 3 (BH3) domain is a potent death domain. BH3-only proteins, including Bad, Bid, Bik, Hrk, Bim, Noxa, and PUMA, form a growing subclass of the Bcl-2 family. A novel BH3-only protein was recently identified in human and mouse and designated Bmf (for Bcl-2-modifing factor). The BH3 domain in Bmf is required both for binding to Bcl-2 proteins and for triggering apoptosis. In healthy cells, Bmf associates with the dynein light chain 2 (DLC2) component of the myosin V motors and is sequestered by the cell's actin cytoskeleton. Disruption of the actin cytoskeleton, either by depolymerization of actin filaments or by detachment of cells from the extracellular matrix, triggers release and activation of Bmf, initiating the downstream apoptotic program. Bmf is constitutively expressed in many tissues.

Supplier: Genetex

Chromatin, the physiological packaging structure of histone proteins and DNA, is considered a key element in regulating gene expression. Several complexes involved in transcriptional regulation function by either modifying histones or altering chromatin structure. Postranslational modifications of histones, such as acetylation, phosphorylation and methylation, contribute to the regulation of transcription. The ATP-dependent chromatin-remodeling complexes alter chromatin structure by using the energy of ATP hydrolysis to locally disrupt the association of histones with DNA, displacing the nucleosomes from promoter and enhancer regions, and therefore allowing transcription initiation. Chromatin remodeling complexes have been purified from a variety of organisms, and most cell types contain more than one type of complex. These complexes contain structurally related catalytic subunits, but differ in the way in which they manipulate chromatin. Three families of complexes have been described the SWI/SNF family, ISWI family, and Mi-2 family. The SWI/SNF family of ATP-dependent remodeling complexes was identified in yeast, drosophila, and human. It causes nucleosomes to change structure and/or position in order to allow transcriptional activators to gain access to their target sites. The SWI/SNF complex was originally identified in yeast as a 2 MDa complex, later shown to be highly conserved in all eukaryotes. Components of the hSWI/SNF complexes have been implicated in a range of cellular events including gene activation, regulation of cell growth, and development. The human homologue of yeast SNF5, SMARCB1, was identified in a two-hybrid screening performed to identify binding targets of the integrase of HIV, and the gene called INI1. Many studies have indicated that yeast SNF and its human counterparts are able to interact with sequence-specific transcription factors, which may recruit the complex to specific genes. For example, it has been shown that SMARCB1 interacts with the protooncogene c-Myc and the SWI complex is necessary for c-Myc mediated transactivation. Mutations in SNF5 and Brg1, both SWI components, suggest a connection of the complex with cancer. In fact, SMARCB1 displays properties of a tumor-suppressor gene, as sporadic rhabdoid tumors show biallelic loss-of-function mutations, and germline mutations confer and autosomal-dominant syndrome that predisposes patients to a variety of rhabdoid cancers.

Supplier: New England Biolabs (NEB)

A complex mixture of peptides produced by Trypsin digestion of Bovine Serum Albumin (BSA) that was reduced and alkylated with Iodoacetamide (CAM modified)

Supplier: ADVANCED BIOMATRIX, INC. MS

Glycosil® is a thiol-modified hyaluronic acid. Glycosil® hyaluronic acid is a component of the HyStem®, HyStem-C and HyStem-HP hydrogel kits but can be purchased separately here.

Supplier: Cytiva

HiTrap Capto DEAE is a weak anion exchanger prepacked with BioProcess Capto resins for screening and small-scale protein purifications using ion exchange chromatography (IEX)..

Supplier: Cytiva

Q Sepharose™ High Performance is composed of crosslinked agarose beads with a mean diameter of 34 µm, modified with quaternary (Q) strong anion exchange groups.

Supplier: Cytiva

Q Sepharose XL is based on a highly cross-linked, bead formed 6% agarose matrix similar to the well established Q Sepharose Fast Flow media.